Transcription Factor

Accessions: 1ig7_A (3D-footprint 20241219)
Names: Homeobox protein Hox-7, Homeobox protein MSX-1, Homeotic protein Msx-1, Hox-7.1, Msh homeobox 1-like protein, MSX1_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P13297
Length: 58
Pfam Domains: 1-57 Homeobox domain
Sequence:
(in bold interface residues)
1 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL
Interface Residues: 1, 2, 3, 4, 42, 43, 45, 46, 49, 50, 52, 53, 54, 57
3D-footprint Homologues: 8ejp_B, 8pmf_A, 2lkx_A, 6m3d_C, 1zq3_P, 7q3o_C, 6es3_K, 2ld5_A, 8ik5_C, 7psx_B, 2hdd_A, 4cyc_A, 8osb_E, 2hos_A, 8eml_B, 9b8u_A, 7xrc_C, 8bx1_A, 8g87_X
Binding Motifs: 1ig7_A cTAATnG
Binding Sites: 1ig7_B
1ig7_C
Publications: Hovde S, Abate-Shen C, Geiger J.H. Crystal structure of the Msx-1 homeodomain/DNA complex. Biochemistry 40:12013-21 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.