Transcription Factor
| Accessions: | YY2_DBD (HumanTF 1.0) |
| Names: | Transcription factor YY2, TYY2_HUMAN, Yin and yang 2, YY-2, YY2, Zinc finger protein 631 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | O15391 |
| Notes: | Ensembl ID: ENSG00000198767; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis |
| Length: | 135 |
| Pfam Domains: | 18-41 C2H2-type zinc finger 46-68 C2H2-type zinc finger 46-68 Zinc finger, C2H2 type 61-86 Zinc-finger double domain 74-98 C2H2-type zinc finger 74-98 Zinc finger, C2H2 type 90-116 Zinc-finger double domain 104-128 C2H2-type zinc finger 104-128 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 FTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSK 60 61 LRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTN 120 121 LKTHILTHVKTKNNP |
| Interface Residues: | 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 56, 57, 58, 59, 60, 61, 62, 63, 64, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93, 112, 113, 116, 117, 118, 119, 120, 121, 122, 123, 127 |
| 3D-footprint Homologues: | 7w1m_H, 5ei9_F, 6wmi_A, 5v3j_F, 6ml4_A, 2i13_A, 4m9v_C, 7eyi_G, 2jpa_A, 1ubd_C, 7n5w_A, 6jnm_A, 1tf3_A, 7y3l_A, 6blw_A, 5kl3_A, 1tf6_A, 6u9q_A, 7txc_E, 5und_A, 7ysf_A, 2kmk_A, 8ssq_A, 1mey_C, 2gli_A, 5kkq_D, 8ssu_A, 4x9j_A, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 3uk3_C, 8cuc_F, 1g2f_F, 2wbs_A, 5yel_A, 1llm_D, 5yj3_D, 5k5i_A, 1f2i_J, 7y3m_I, 8gn3_A, 5w5y_Q |
| Binding Motifs: | YY2_DBD gwcCGCCATtw |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.