Transcription Factor
| Accessions: | T22029 (AthalianaCistrome v4_May2016), Q9FH80 (JASPAR 2024) |
| Names: | AT5G45300, BAM8, T22029;, 1,4-alpha-D-glucan maltohydrolase, BAM8_ARATH, Beta-amylase 2, Beta-amylase 8, EC 3.2.1.2 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:BES1 |
| Length: | 689 |
| Pfam Domains: | 82-232 Plant protein of unknown function (DUF822) 260-646 Glycosyl hydrolase family 14 |
| Sequence: | MHTLNNTITTTTGSQDPNLDPIPDPDQFPNRNRNQPQSRRPRGFAAAAAAASIAPTENDV NNGNIAGIGGGEGSSGGGGGGGGKGKREREKEKERTKLRERHRRAITSRMLAGLRQYGNF PLPARADMNDVIAALAREAGWSVEADGTTYRQSQQPNHVVQFPTRSIESPLSSSTLKNCA KAAIESQQHSVLRNDEKLAPVSLDSIGIAESDHPGNGRYTSVSPITSVGCLEANQLIQDV HSAEQCNDFTESFYVPVYAMLPVGIIDNFGQLVDPEGVRQELSYMKSLNVDGVVIDCWWG IVEGWNPQKYVWSGYRELFNLIRDFKLKLQVVMAFHEYGGNASGNVMISLPQWVLKIGKD NPDIFFTDREGRRSFECLNWSIDKERVLHGRTGIEVYFDFMRSFRSEFDDLFVEGLITAV EIGLGASGELKYPSFPERMGWIYPGIGEFQCYDKYSQLSLQKEAKSRGFTFWGKGPENAG QYSSHPHETVFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPA IYWSYKTASHAAELTAGYYNPSNRDGYSLVFETLKKYSVTVKFVCPGPQMSPNAHEEALA DPEGLSWQVINAAWDKGLQIGGENAITCFDRDGCMRLIDIAKPRNHPDGYHFSFFTYRQP SPLVQGSTCFPDLDYFIKRMHGDIRDKQF |
| Binding Motifs: | M0154 yCACACGTGysaamt M0155 arttsrCACGTGTsr MA2014.1 ytCACACGTGysaa MA2014.2 CACACGTGy MA2375.1 srCACGTGTGr |
| Binding Sites: | MA2014.1.5 MA2014.1.6 MA2014.1.3 / MA2014.1.4 MA2014.1.1 MA2014.1.10 MA2014.1.11 MA2014.1.12 MA2014.1.13 MA2014.1.14 MA2014.1.15 MA2014.1.16 MA2014.1.17 MA2014.1.18 MA2014.1.19 MA2014.1.2 MA2014.1.20 MA2014.1.7 MA2014.1.8 MA2014.1.9 MA2014.2.1 / MA2014.2.2 MA2014.2.10 MA2014.2.11 MA2014.2.12 MA2014.2.13 MA2014.2.14 / MA2014.2.16 / MA2014.2.17 / MA2014.2.18 / MA2014.2.19 / MA2014.2.3 / MA2014.2.4 / MA2014.2.7 / MA2014.2.8 MA2014.2.15 MA2014.2.20 MA2014.2.5 MA2014.2.6 MA2014.2.9 |
| Publications: | Reinhold H, Soyk S, Simková K, Hostettler C, Marafino J, Mainiero S, Vaughan CK, Monroe JD, Zeeman SC. β-amylase-like proteins function as transcription factors in Arabidopsis, controlling shoot growth and development. Plant Cell 23:1391-403 (2011). [Pubmed] Yu X, Li L, Zola J, Aluru M, Ye H, Foudree A, Guo H, Anderson S, Aluru S, Liu P, Rodermel S, Yin Y. A brassinosteroid transcriptional network revealed by genome-wide identification of BESI target genes in Arabidopsis thaliana. Plant J 65:634-46 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.