Transcription Factor

Accessions: 4s0h_E (3D-footprint 20250804)
Names: T-box protein 5, T-box transcription factor TBX5, TBX5_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q99593
Length: 177
Pfam Domains: 4-176 T-box
Sequence:
(in bold interface residues)
1 GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDH 60
61 RYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHII 120
121 LNSMHKYQPRLHIVKADTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRG
Interface Residues: 29, 154, 155, 171, 174, 175
3D-footprint Homologues: 4a04_B, 1h6f_B, 5flv_I, 1xbr_B, 6f59_B, 2x6v_A
Binding Motifs: 4s0h_EF CACnnnnnAAGTG
Publications: Pradhan L, Gopal S, Li S, Ashur S, Suryanarayanan S, Kasahara H, Nam HJ. Intermolecular Interactions of Cardiac Transcription Factors NKX2. 5 and TBX5 55:1702-10 (Biochemistry.). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.