Transcription Factor
| Accessions: | 1ga5_A (3D-footprint 20250804) |
| Names: | EAR-1, NR1D1_HUMAN, Nuclear receptor subfamily 1 group D member 1, ORPHAN NUCLEAR RECEPTOR NR1D1, Rev-erbA-alpha, V-erbA-related protein 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P20393 |
| Length: | 82 |
| Pfam Domains: | 3-72 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 VLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQC 60 61 RFKKCLSVGMSRDAVRFGRIPK |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 55, 77, 79, 81 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | 1ga5_AB AnnAGGTCACnnGGGCA |
| Publications: | Sierk M.L, Zhao Q, Rastinejad F. DNA deformability as a recognition feature in the reverb response element. Biochemistry 40:12833-43 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.