Transcription Factor
| Accessions: | Q96MM3 (JASPAR 2024) |
| Names: | hREX-1, Reduced expression protein 1, REX-1, Zfp-42, ZFP42_HUMAN, Zinc finger protein 42 homolog, Zinc finger protein 754 |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 310 |
| Pfam Domains: | 189-212 C2H2-type zinc finger 204-227 Zinc-finger double domain 217-239 C2H2-type zinc finger 217-239 Zinc finger, C2H2 type 232-257 Zinc-finger double domain 245-269 C2H2-type zinc finger 245-269 Zinc finger, C2H2 type 261-286 Zinc-finger double domain 275-299 C2H2-type zinc finger 275-299 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGP 60 61 QALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSL 120 121 EYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINK 180 181 EYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHT 240 241 GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA 300 301 NTNKNEQEGK |
| Interface Residues: | 166, 167, 170, 200, 201, 202, 203, 204, 206, 207, 208, 209, 210, 227, 228, 229, 230, 231, 232, 233, 234, 235, 254, 256, 257, 258, 259, 260, 261, 263, 264, 268, 287, 288, 289, 290, 291, 293, 294 |
| 3D-footprint Homologues: | 2i13_A, 7w1m_H, 6ml4_A, 8gn3_A, 2kmk_A, 6wmi_A, 5ei9_F, 4m9v_C, 7eyi_G, 7ysf_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 7n5w_A, 1tf3_A, 6jnm_A, 8cuc_F, 1mey_C, 5und_A, 2drp_D, 6blw_A, 5k5i_A, 2gli_A, 7txc_E, 5kkq_D, 1tf6_A, 4x9j_A, 8ssq_A, 5kl3_A, 8ssu_A, 8h9h_G, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 1f2i_J, 6u9q_A, 5v3j_F, 1g2f_F, 5yj3_D, 1llm_D, 2wbs_A |
| Binding Motifs: | MA1651.1 swtccAArATGGCTGCcycsr MA1651.2 cAArATGGCTGCc |
| Binding Sites: | MA1651.1.1 MA1651.1.10 MA1651.1.11 MA1651.1.12 MA1651.1.13 / MA1651.1.7 MA1651.1.14 MA1651.1.15 / MA1651.1.8 MA1651.1.16 MA1651.1.17 MA1651.1.18 / MA1651.1.9 MA1651.1.10 / MA1651.1.19 MA1651.1.1 / MA1651.1.2 MA1651.1.11 / MA1651.1.20 MA1651.1.3 MA1651.1.2 / MA1651.1.4 MA1651.1.3 / MA1651.1.5 MA1651.1.4 / MA1651.1.6 MA1651.1.5 / MA1651.1.7 MA1651.1.8 MA1651.1.6 / MA1651.1.9 MA1651.1.12 MA1651.1.13 MA1651.1.14 MA1651.1.15 MA1651.1.16 MA1651.1.17 MA1651.1.18 MA1651.1.19 MA1651.1.20 MA1651.2.1 MA1651.2.10 MA1651.2.11 MA1651.2.12 MA1651.2.13 MA1651.2.14 MA1651.2.15 MA1651.2.16 MA1651.2.17 MA1651.2.18 MA1651.2.19 MA1651.2.2 MA1651.2.20 MA1651.2.3 MA1651.2.4 MA1651.2.5 MA1651.2.6 MA1651.2.7 MA1651.2.8 MA1651.2.9 |
| Publications: | Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.