Transcription Factor
Accessions: | FOXK1_DBD (HumanTF 1.0), FOXK1 (HT-SELEX2 May2017) |
Names: | Cellular transcription factor ILF-1, Forkhead box protein K2, FOXK1, FOXK2_HUMAN, Interleukin enhancer-binding factor 1, ENSG00000164916 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q01167 |
Notes: | Ensembl ID: ENSG00000164916; DNA-binding domain sequence; TF family: Forkhead; Clone source: Gene synthesis, TF family: Forkhead experiment: HT-SELEX Hamming distance: 1 cycle: 2b0, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2b0 |
Length: | 125 |
Pfam Domains: | 15-110 Fork head domain |
Sequence: (in bold interface residues) | 1 QADTSGGDSPKDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQ 60 61 NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFG 120 121 PLSSR |
Interface Residues: | 38, 57, 58, 60, 61, 62, 64, 65, 66, 68, 69, 78, 85, 107, 110 |
3D-footprint Homologues: | 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 8sro_B |
Binding Motifs: | FOXK1_DBD CGGACACAAT FOXK1_2 watrTmAAYAa FOXK1_methyl_1 vwygtAAayAr |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.