Transcription Factor
| Accessions: | Q9D030 (JASPAR 2024) |
| Names: | Dermis-expressed protein 1, Dermo-1, Twist-related protein 2, TWST2_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9D030 |
| Length: | 160 |
| Pfam Domains: | 67-117 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQS 60 61 FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV 120 121 LQSDEMDNKMTSCSYVAHERLSYAYSVWRMEGAWSMSASH |
| Interface Residues: | 68, 69, 71, 72, 73, 74, 75, 76, 78, 79, 86, 88, 103 |
| 3D-footprint Homologues: | 2ypa_A, 1gdt_A, 6od3_F, 5eyo_A, 5i50_B, 2ypa_B, 2ql2_A, 2ql2_D, 7z5k_B, 7ssa_L, 5gnj_I |
| Binding Motifs: | MA0633.1 rmCATATGTk MA0633.2 vvCAGCTGbb MA0633.3 CAGCTG |
| Binding Sites: | MA0633.3.1 / MA0633.3.10 / MA0633.3.11 / MA0633.3.12 / MA0633.3.13 / MA0633.3.14 / MA0633.3.15 / MA0633.3.16 / MA0633.3.19 / MA0633.3.2 / MA0633.3.20 / MA0633.3.3 / MA0633.3.4 / MA0633.3.5 / MA0633.3.6 / MA0633.3.7 / MA0633.3.8 / MA0633.3.9 MA0633.2.1 / MA0633.2.9 MA0633.2.10 / MA0633.2.2 MA0633.2.11 / MA0633.2.12 MA0633.2.13 MA0633.2.14 MA0633.2.15 MA0633.2.16 MA0633.2.17 MA0633.2.18 MA0633.2.17 / MA0633.2.19 MA0633.2.18 / MA0633.2.20 MA0633.2.3 MA0633.2.4 MA0633.2.5 MA0633.2.6 MA0633.2.7 MA0633.2.8 MA0633.2.19 MA0633.2.20 MA0633.3.17 MA0633.3.18 |
| Publications: | Kophengnavong T, Michnowicz J.E, Blackwell T.K. Establishment of distinct MyoD, E2A, and twist DNA binding specificities by different basic region-DNA conformations. Molecular and cellular biology 20:261-72 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.