Transcription Factor

						

			
Accessions: 2r5y_B (3D-footprint 20231221), 2r5z_B (3D-footprint 20231221)

			
Names: Dpbx, EXD_DROME, Homeobox protein extradenticle
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P40427
Length: 59
Pfam Domains:      1-57 Homeobox domain
    16-54 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Interface Residues: 1, 2, 4, 42, 43, 45, 46, 49, 50, 53, 54, 57
3D-footprint Homologues: 1fjl_B, 4j19_B, 1au7_A, 5zjt_E, 3cmy_A, 1b72_A, 1puf_B, 3d1n_M, 2lkx_A, 2ld5_A, 5jlw_D, 7q3o_C, 1ic8_B, 1le8_A, 1ig7_A, 1mnm_C, 7psx_B, 5zfz_A, 3a01_E, 2d5v_B, 1k61_B, 6fqp_B, 5flv_I, 3lnq_A, 1puf_A, 4qtr_D, 2h1k_B, 6fqq_E, 5hod_A, 3rkq_B, 8g87_X, 6a8r_A, 4xrm_B, 2hdd_A, 1le8_B, 6m3d_C, 1du0_A, 4cyc_A, 2r5y_A, 1zq3_P, 1jgg_B, 6es3_K, 4xrs_G, 3l1p_A, 2hos_A
Binding Motifs: 2r5y_AB TGATTTAwgG
2r5z_AB AGATTAATcGG
2r5z_B aGAt
Binding Sites: 2r5y_C
2r5y_D
2r5z_C
2r5z_D
			
Publications: Joshi R, Passner J.M, Rohs R, Jain R, Sosinsky A, Crickmore M.A, Jacob V, Aggarwal A.K, Honig B, Mann R.S. Functional specificity of a Hox protein mediated by the recognition of minor groove structure. Cell 131:530-43 (2007). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.