Transcription Factor
Accessions: | 1h8a_A (3D-footprint 20241219) |
Names: | C/EBP beta, CAAT/ENHANCER BINDING PROTEIN BETA, CCAAT/enhancer-binding protein beta, CEBPB_HUMAN, LAP, LIP, Liver activator protein, Liver-enriched inhibitory protein, Nuclear factor NF-IL6, TCF-5, Transcription factor 5 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P17676 |
Length: | 68 |
Pfam Domains: | 4-57 Basic region leucine zipper 5-63 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELST 60 61 LRNLFKQL |
Interface Residues: | 12, 15, 16, 18, 19, 22, 23 |
3D-footprint Homologues: | 8k8c_A, 8k86_A, 2c9l_Z, 2dgc_A |
Binding Motifs: | 1h8a_ABC TCCGTTAnnnGTTGCGCCAC |
Publications: | Tahirov T.H, Sato K, Ichikawa-Iwata E, Sasaki M, Inoue-Bungo T, Shiina M, Kimura K, Takata S, Fujikawa A, Morii H, Kumasaka T, Yamamoto M, Ishii S, Ogata K. Mechanism of c-Myb-C/EBP beta cooperation from separated sites on a promoter. Cell 108:57-70 (2002). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.