Transcription Factor
| Accessions: | T08045 (AthalianaCistrome v4_May2016), O22131 (JASPAR 2024) |
| Names: | AT2G45420, LBD18, T08045;, AS2-like protein 20, ASYMMETRIC LEAVES 2-like protein 20, LBD18_ARATH, LOB domain-containing protein 18 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:LOB-AS2 |
| Length: | 262 |
| Pfam Domains: | 37-137 Protein of unknown function DUF260 |
| Sequence: (in bold interface residues) | 1 MSGGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGGPCGACKFLRRKCVPGCIFAPYFDS 60 61 EQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICYEAQARIRDPIYGCVAHIFAL 120 121 QQQVVNLQAEVSYLQAHLASLELPQPQTRPQPMPQPQPLFFTPPPPLAITDLPASVSPLP 180 181 STYDLASIFDQTTSSSAWATQQRRFIDPRHQYGVSSSSSSVAVGLGGENSHDLQALAHEL 240 241 LHRQGSPPPAATDHSPSRTMSR |
| Interface Residues: | 93, 94, 219, 221, 223, 230, 240, 242, 243 |
| 3D-footprint Homologues: | 1w0t_A, 1j4w_A |
| Binding Motifs: | M0466 CggaWTTTccGSmrr M0470 wytycksCggawTTTCcGs MA1673.1 tcGCCGGAAAww MA1673.2 GCCGGAAA |
| Binding Sites: | MA1673.2.1 MA1673.2.19 / MA1673.2.3 MA1673.2.13 / MA1673.2.15 / MA1673.2.16 / MA1673.2.6 MA1673.2.2 / MA1673.2.9 MA1673.2.10 MA1673.1.1 MA1673.1.10 / MA1673.1.5 MA1673.1.11 / MA1673.1.6 MA1673.1.12 / MA1673.1.8 MA1673.1.13 / MA1673.1.9 MA1673.1.10 / MA1673.1.14 MA1673.1.15 MA1673.1.13 / MA1673.1.16 MA1673.1.15 / MA1673.1.17 MA1673.1.16 / MA1673.1.18 MA1673.1.17 / MA1673.1.19 MA1673.1.2 MA1673.1.18 / MA1673.1.20 MA1673.1.3 MA1673.1.4 MA1673.1.2 / MA1673.1.5 MA1673.1.6 MA1673.1.3 / MA1673.1.7 MA1673.1.8 MA1673.1.4 / MA1673.1.9 MA1673.1.11 MA1673.1.12 MA1673.1.14 MA1673.1.19 MA1673.1.20 MA1673.1.7 MA1673.2.11 MA1673.2.12 MA1673.2.14 MA1673.2.17 / MA1673.2.18 / MA1673.2.20 MA1673.2.4 MA1673.2.5 / MA1673.2.8 MA1673.2.7 |
| Publications: | Pandey SK, Lee HW, Kim MJ, Cho C, Oh E, Kim J. LBD18 uses a dual mode of a positive feedback loop to regulate ARF expression and transcriptional activity in Arabidopsis. Plant J 95:233-251 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.