Transcription Factor

						

			
Accessions: hkb (FlyZincFinger 1.0 )

			
Names: CG9768
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 86
Pfam Domains:      2-24 C2H2-type zinc finger
     2-24 Zinc finger, C2H2 type
     2-12 C2H2-type zinc finger
    17-43 Zinc-finger double domain
    30-54 C2H2-type zinc finger
    30-54 Zinc finger, C2H2 type
    36-52 C2H2-type zinc finger
    47-70 Zinc-finger double domain
    60-82 C2H2-type zinc finger
    60-82 Zinc finger, C2H2 type
    60-83 C2H2-type zinc finger
    62-80 Zinc-finger of C2H2 type
Sequence: 
(in bold interface residues)		   1 KFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPY   60
  61 PCSACGKKFGRRDHLKKHMKTHMPQE
Interface Residues: 2, 12, 13, 14, 15, 16, 18, 19, 21, 22, 23, 25, 40, 42, 43, 44, 45, 46, 48, 49, 50, 70, 71, 72, 73, 74, 75, 76, 77, 78
3D-footprint Homologues: 2kmk_A, 6jnm_A, 1tf3_A, 6ml4_A, 7n5w_A, 5k5i_A, 7ysf_A, 4x9j_A, 8ssq_A, 2gli_A, 7w1m_H, 6blw_A, 5k5l_F, 1tf6_A, 6u9q_A, 5ei9_F, 8ssu_A, 1g2f_F, 5kkq_D, 1ubd_C, 8gn3_A, 8h9h_G, 5v3j_F, 7y3m_I, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 5gzb_A, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 5kl3_A, 2drp_D, 7txc_E, 1f2i_J, 2wbs_A, 5yel_A, 4m9v_C, 5yj3_D
Binding Motifs: hkb_NAR_FBgn0001204 kRGGCGTGA
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.