Transcription Factor

Accessions: SOX12 (HT-SELEX2 May2017)
Names: ENSG00000177732, SOX12
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: HMG experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: HMG experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 107
Pfam Domains: 17-85 HMG (high mobility group) box
18-75 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 EEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQD 60
61 SEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGS
Interface Residues: 19, 22, 24, 25, 28, 32, 43, 44, 45, 48, 86, 90, 100
3D-footprint Homologues: 3tmm_A, 7m5w_A, 2gzk_A, 3u2b_C, 1j5n_A, 2lef_A, 4s2q_D, 1o4x_B, 3f27_D, 4y60_C, 1qrv_A, 1hry_A, 1ckt_A
Binding Motifs: SOX12_2 aCCGAACAATg
SOX12_methyl_1 AccGAACAATr
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.