Transcription Factor

Accessions: PAX1_DBD (HumanTF 1.0), PAX1_TF2 (HumanTF2 1.0), PAX1 (HT-SELEX2 May2017)
Names: HuP48, Paired box protein Pax-1, PAX1, PAX1_HUMAN, ENSG00000125813
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P15863
Notes: Ensembl ID: ENSG00000125813; DNA-binding domain sequence; TF family: PAX; Clone source: Gene synthesis, Ensembl ID: ENSG00000125813; Construct type: TF2(3xFLAG); TF family: PAX; Clone source: Jolma et al. 2013, TF family: PAX experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: PAX experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 154
Pfam Domains: 4-127 'Paired box' domain
23-63 Homeodomain-like domain
Sequence:
(in bold interface residues)
1 EQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYN 60
61 ETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVS 120
121 SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYN
Interface Residues: 16, 48, 49, 53, 54, 70, 73, 118, 120, 121, 123, 124
3D-footprint Homologues: 1k78_A
Binding Motifs: PAX1_DBD sGTCACGCwTSAsTGmm
ELK1_PAX1 aCCGGAACyACGCwTsRsYg
HOXB2_PAX1_1 ysGTCACGChyCATTdm
HOXB2_PAX1_2 rymaTtaGTCACGCwTsrcTG
PAX1_2 csGTCACGCwYsAcTGm
PAX1_methyl_1 ysGTCACGCwTsAsyGm
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.