Transcription Factor
| Accessions: | 6ryl_D (3D-footprint 20250804) |
| Names: | AtWUS, Plant growth activator 6, Protein WUSCHEL, WUS_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9SB92 |
| Length: | 63 |
| Pfam Domains: | 1-61 Homeobox domain |
| Sequence: (in bold interface residues) | 1 TRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARER 60 61 QKK |
| Interface Residues: | 2, 49, 50, 53, 54, 57, 58 |
| 3D-footprint Homologues: | 6ryd_F, 6wig_A, 5hod_A |
| Binding Motifs: | 6ryl_DE TyAATGCGTTsT |
| Publications: | Sloan J, Hakenjos JP, Gebert M, Ermakova O, Gumiero A, Stier G, Wild K, Sinning I, Lohmann JU. Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL. Nat Commun 11:2223 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.