Transcription Factor

						

			
Accessions: ZNF238_DBD (HumanTF 1.0)

			
Names: 58 kDa repressor protein, TAZ-1, Transcriptional repressor RP58, Translin-associated zinc finger protein 1, Zinc finger and BTB domain-containing protein 18, Zinc finger protein 238, Zinc finger protein C2H2-171, ZN238_HUMAN, ZNF238
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q99592
Notes: Ensembl ID: ENSG00000179456; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC
Length: 155
Pfam Domains:     21-41 Zinc-finger of C2H2 type
    21-43 Zinc finger, C2H2 type
    22-43 C2H2-type zinc finger
    62-81 Zinc-finger of C2H2 type
    62-83 Zinc finger, C2H2 type
    63-83 C2H2-type zinc finger
    76-98 Zinc-finger double domain
   89-111 Zinc finger, C2H2 type
   89-111 C2H2-type zinc finger
  103-128 Zinc-finger double domain
  117-140 Zinc finger, C2H2 type
  117-140 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MAESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNV   60
  61 PTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACK  120
 121 WCERRFTQSGDLYRHIRKFHCELVNSLSVKSEALS
Interface Residues: 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 44, 47, 51, 71, 72, 73, 74, 75, 77, 78, 79, 99, 100, 101, 102, 103, 104, 105, 106, 107, 110, 127, 128, 129, 130, 131, 132, 133, 134, 138, 150, 152, 153
3D-footprint Homologues: 7n5w_A, 7w1m_H, 5k5l_F, 8ssu_A, 5v3j_F, 2i13_A, 5kkq_D, 5yel_A, 5ei9_F, 8ssq_A, 2gli_A, 1g2f_F, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 1tf3_A, 6jnm_A, 8cuc_F, 1tf6_A, 6ml4_A, 4x9j_A, 8gn3_A, 6blw_A, 6u9q_A, 1mey_C, 5kl3_A, 5k5i_A, 2kmk_A, 5und_A, 8h9h_G, 4m9v_C, 2lt7_A, 7y3m_I, 6a57_A, 1llm_D, 2wbs_A, 7txc_E, 2drp_D, 1f2i_J, 5yj3_D
Binding Motifs: ZNF238_DBD awTCCAGATGTkb
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.