Transcription Factor

						

			
Accessions: 4wls_A (3D-footprint 20231221), 4wls_B (3D-footprint 20231221)

			
Names: Copper efflux regulator, Copper export regulator, CUER_ECOLI, HTH-type transcriptional regulator CueR
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A9G4
Length: 111
Pfam Domains:      1-67 MerR HTH family regulatory protein
     2-39 MerR family regulatory protein
   45-108 MerR, DNA binding
Sequence: 
(in bold interface residues)		   1 MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNL   60
  61 EESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQLLALANA
Interface Residues: 15, 18, 19, 22, 23, 36, 37
3D-footprint Homologues: 6xh7_H, 2zhg_A, 7tec_A, 5d8c_A, 1r8d_B, 6xl5_H, 4r24_B, 6jgx_B, 1r8e_A, 7ckq_G, 4r4e_B, 6ldi_G, 2vz4_A, 7tea_B, 5c8e_C
Binding Motifs: 4wls_AB GnnnCCnCnnTTTGGnnnG
4wls_B CTGGannG
Binding Sites: 4wls_X
4wls_Y
			
Publications: Philips SJ, Canalizo-Hernandez M, Yildirim I, Schatz GC, Mondragón A, O'Halloran TV. TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter 349:877-81 (Science.). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.