Transcription Factor

Accessions: 5zdz_N (3D-footprint 20231221), 5ze2_N (3D-footprint 20231221)
Names: High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1 A-B box, HMGB1_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 117
Pfam Domains: 2-62 Domain of unknown function (DUF1898)
3-63 HMG (high mobility group) box
63-117 HMG (high mobility group) box
63-116 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 GKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAKEKGKFEDMAKADKARYER 60
61 EMKRPPSAFFLFCSEYRPKIKGEIGDVAKKLGEMWNNTDDKQPYEKKAAKLKEKYEK
Interface Residues: 4, 6, 7, 10, 28, 32, 64, 67, 69, 70, 73, 77, 84, 85, 88
3D-footprint Homologues: 1j5n_A, 1ckt_A, 4y60_C, 3f27_D, 6jrp_D, 1o4x_B, 3u2b_C, 7m5w_A, 1qrv_A, 4s2q_D, 2gzk_A, 1hry_A
Binding Motifs: 5zdz_CN CTnnCTnnnnACTTnnnnnnnnnnnnnGT
5ze2_N CTnnnnnnnnacTT
Binding Sites: 5zdz_G
5zdz_M
5ze2_G
5ze2_M
Publications: Kim MS, Chuenchor W, Chen X, Cui Y, Zhang X, Zhou ZH, Gellert M, Yang W. Cracking the DNA Code for V(D)J Recombination. Mol Cell 70:358-370 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.