Transcription Factor

						

			
Accessions: 5z2t_D (3D-footprint 20231221), 6dfy_C (3D-footprint 20231221)

			
Names: Double homeobox protein 10, Double homeobox protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 54
Pfam Domains:      1-52 Homeobox domain
    21-51 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPG
Interface Residues: 1, 10, 11, 14, 39, 40, 42, 43, 46, 47, 50, 51
3D-footprint Homologues: 2hos_A, 1nk2_P, 5hod_A, 3a01_E, 1ig7_A, 6a8r_A, 3lnq_A, 2ld5_A, 7q3o_C, 5jlw_D, 3cmy_A, 2h1k_B, 1jgg_B, 6es3_K, 1au7_A, 4xrs_G, 3rkq_B, 2lkx_A, 1puf_A, 1fjl_B, 5zfz_A, 3d1n_M, 2hdd_A, 1b72_A, 5flv_I, 4cyc_A, 2r5y_A, 5zjt_E, 4e0g_A, 4f43_A, 1e3o_C, 7xrc_C, 4j19_B, 1le8_A, 1ic8_B, 3l1p_A, 7psx_B, 1du0_A, 1zq3_P, 4xrm_B, 1o4x_A, 1puf_B, 8g87_X, 4qtr_D, 6m3d_C
Binding Motifs: 5z2t_CD TTAsaTTA
5z2t_D TAAt
6dfy_C AGAnAA
6dfy_CD TnATCTnATC
Binding Sites: 5z2t_E
5z2t_F
6dfy_E
6dfy_F
			
Publications: Dong X, Zhang W, Wu H, Huang J, Zhang M, Wang P, Zhang H, Chen Z, Chen SJ, Meng G. Structural basis of DUX4/IGH-driven transactivation. Leukemia : (2018). [Pubmed]


Aihara H, Shi K, Lee JK, Bosnakovski D, Kyba M. Comment on structural basis of DUX4/IGH-driven transactivation. Leukemia 32:2090-2092 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.