Transcription Factor

Accessions: HOXA9 (HT-SELEX2 May2017), P31269 (JASPAR 2024)
Names: ENSG00000078399, HOXA9, Homeobox protein Hox-1G, Homeobox protein Hox-A9, HXA9_HUMAN
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: P31269
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 272
Pfam Domains: 1-193 Hox9 activation region
207-263 Homeobox domain
Sequence:
(in bold interface residues)
1 MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA 60
61 TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS 120
121 FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA 180
181 ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA 240
241 RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
Interface Residues: 207, 208, 209, 210, 248, 249, 251, 252, 255, 256, 258, 259, 260, 261, 263
3D-footprint Homologues: 5zfz_A, 1fjl_B, 3cmy_A, 8ejp_B, 1puf_A, 8pmf_A, 1ig7_A, 3d1n_M, 6a8r_A, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 2ld5_A, 6es3_K, 7q3o_C, 5jlw_D, 8ik5_C, 4xrs_G, 3a01_E, 3rkq_B, 8osb_E, 6m3d_C, 5flv_I, 2hdd_A, 1b72_A, 5zjt_E, 4cyc_A, 2r5y_A, 7psx_B, 2hos_A, 8eml_B, 1puf_B, 9b8u_A, 1e3o_C, 7xrc_C, 1au7_A, 1le8_A, 2xsd_C, 1k61_B, 1o4x_A, 5hod_A, 1mnm_C, 1du0_A, 4qtr_D
Binding Motifs: HOXA9_3 / MA0594.2 rtCRTwAays
HOXA9_4 GymaTwAmms
HOXA9_methyl_1 rTCGTwAays
HOXA9_methyl_2 gymaTwAmms
MA0594.3 rtCRTwA
Publications: LaRonde-LeBlanc N.A, Wolberger C. Structure of HoxA9 and Pbx1 bound to DNA: Hox hexapeptide and DNA recognition anterior to posterior. Genes & development 17:2060-72 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.