Transcription Factor
| Accessions: | HOXA9 (HT-SELEX2 May2017), P31269 (JASPAR 2024) |
| Names: | ENSG00000078399, HOXA9, Homeobox protein Hox-1G, Homeobox protein Hox-A9, HXA9_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P31269 |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 272 |
| Pfam Domains: | 1-193 Hox9 activation region 207-263 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA 60 61 TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS 120 121 FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA 180 181 ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA 240 241 RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
| Interface Residues: | 207, 208, 209, 210, 248, 249, 251, 252, 255, 256, 258, 259, 260, 261, 263 |
| 3D-footprint Homologues: | 5zfz_A, 1fjl_B, 3cmy_A, 8ejp_B, 1puf_A, 8pmf_A, 1ig7_A, 3d1n_M, 6a8r_A, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 2ld5_A, 6es3_K, 7q3o_C, 5jlw_D, 8ik5_C, 4xrs_G, 3a01_E, 3rkq_B, 8osb_E, 6m3d_C, 5flv_I, 2hdd_A, 1b72_A, 5zjt_E, 4cyc_A, 2r5y_A, 7psx_B, 2hos_A, 8eml_B, 1puf_B, 9b8u_A, 1e3o_C, 7xrc_C, 1au7_A, 1le8_A, 2xsd_C, 1k61_B, 1o4x_A, 5hod_A, 1mnm_C, 1du0_A, 4qtr_D |
| Binding Motifs: | HOXA9_3 / MA0594.2 rtCRTwAays HOXA9_4 GymaTwAmms HOXA9_methyl_1 rTCGTwAays HOXA9_methyl_2 gymaTwAmms MA0594.3 rtCRTwA |
| Publications: | LaRonde-LeBlanc N.A, Wolberger C. Structure of HoxA9 and Pbx1 bound to DNA: Hox hexapeptide and DNA recognition anterior to posterior. Genes & development 17:2060-72 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.