Transcription Factor
| Accessions: | Q8VZI9 (JASPAR 2024) |
| Names: | Agrobacterium tumefaciens VirF-interacting protein 3, AT3g11100/F11B9_105, EIN2 nuclear associated protein 1, ENAP1_ARATH, Q8VZI9_ARATH, Sequence-specific DNA binding transcription factor, Trihelix DNA-binding protein ENAP1, Trihelix transcription factor ENAP1 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8VZI9 |
| Length: | 249 |
| Pfam Domains: | 20-103 Myb/SANT-like DNA-binding domain 38-104 Alcohol dehydrogenase transcription factor Myb/SANT-like |
| Sequence: | METTPETQSKTHRLPAGREDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNS SHGNGRPKTDVQCKNRIDTLKKKYKTEKAKPLSNWCFFDRLDFLIGPVMKKSSGAVVKSA LMNPNLNPTGSKSTGSSLDDDDDDDDDDEEDDDDAGDWGFVVRKHRKVEDVDSSEGSAFR ELARSILKLGEAFERIEGKKQQMMIELEKQRMEVAKELELQRMNMLMEMQLELEKSKLGK RRAASGKKL |
| Binding Motifs: | UN0353.1 ygmCGGCGAsrr UN0353.2 mCGGCGA |
| Binding Sites: | UN0353.1.1 UN0353.1.10 / UN0353.1.3 UN0353.1.11 UN0353.1.12 UN0353.1.13 UN0353.1.14 UN0353.1.15 UN0353.1.16 UN0353.1.17 UN0353.1.18 UN0353.1.19 UN0353.1.2 UN0353.1.20 UN0353.1.3 UN0353.1.4 UN0353.1.5 UN0353.1.1 / UN0353.1.6 UN0353.1.7 UN0353.1.8 UN0353.1.2 / UN0353.1.9 UN0353.1.10 UN0353.1.11 UN0353.1.12 UN0353.1.13 UN0353.1.14 UN0353.1.15 UN0353.1.16 UN0353.1.17 UN0353.1.18 UN0353.1.19 UN0353.1.20 UN0353.1.4 UN0353.1.5 UN0353.1.6 UN0353.1.7 UN0353.1.8 UN0353.1.9 UN0353.2.5 / UN0353.2.6 UN0353.2.14 UN0353.2.19 UN0353.2.3 UN0353.2.18 / UN0353.2.2 UN0353.2.1 / UN0353.2.10 / UN0353.2.12 / UN0353.2.13 / UN0353.2.9 UN0353.2.11 / UN0353.2.15 / UN0353.2.17 / UN0353.2.4 / UN0353.2.8 UN0353.2.16 / UN0353.2.20 UN0353.2.7 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.