Transcription Factor
| Accessions: | ZNF250 (HT-SELEX2 May2017) |
| Names: | ENSG00000196150, ZNF250 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3b0, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0 |
| Length: | 380 |
| Pfam Domains: | 20-42 Zinc finger, C2H2 type 21-42 C2H2-type zinc finger 34-58 Zinc-finger double domain 48-68 C2H2-type zinc finger 48-70 Zinc finger, C2H2 type 48-70 C2H2-type zinc finger 63-85 Zinc-finger double domain 75-86 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type 76-95 C2H2-type zinc finger 91-115 Zinc-finger double domain 103-124 C2H2-type zinc finger 104-126 Zinc finger, C2H2 type 104-126 C2H2-type zinc finger 119-143 Zinc-finger double domain 132-154 C2H2-type zinc finger 132-154 Zinc finger, C2H2 type 132-154 C2H2-type zinc finger 147-170 Zinc-finger double domain 159-178 C2H2-type zinc finger 160-182 C2H2-type zinc finger 160-182 Zinc finger, C2H2 type 175-198 Zinc-finger double domain 187-206 C2H2-type zinc finger 188-210 Zinc finger, C2H2 type 188-210 C2H2-type zinc finger 204-227 Zinc-finger double domain 215-234 C2H2-type zinc finger 216-238 Zinc finger, C2H2 type 216-238 C2H2-type zinc finger 231-254 Zinc-finger double domain 244-266 Zinc finger, C2H2 type 244-266 C2H2-type zinc finger 244-266 C2H2-type zinc finger 259-282 Zinc-finger double domain 272-290 C2H2-type zinc finger 272-294 Zinc finger, C2H2 type 272-294 C2H2-type zinc finger 287-310 Zinc-finger double domain 300-322 C2H2-type zinc finger 300-322 Zinc finger, C2H2 type 300-322 C2H2-type zinc finger 317-338 Zinc-finger double domain 327-348 C2H2-type zinc finger 328-350 Zinc finger, C2H2 type 328-350 C2H2-type zinc finger 344-366 Zinc-finger double domain 355-380 C2H2-type zinc finger 356-378 Zinc finger, C2H2 type 356-378 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 LSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSVCGKAFSQS 60 61 SVLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHECLECRKAFTQLSHLI 120 121 QHQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCNECGKTFSVKRTLLQHQR 180 181 IHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECSECGKTFSHRSTLMNHERIHTE 240 241 EKPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCGECGHAFSARRSLIQHERIHTGEKPF 300 301 QCTECGKAFSLKATLIVHLRTHTGEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECGE 360 361 CGRAFNQHGHLIQHQKVHRK |
| Interface Residues: | 30, 31, 33, 34, 37, 41, 48, 58, 59, 60, 61, 62, 65, 66, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 114, 115, 116, 117, 118, 120, 121, 124, 142, 143, 144, 145, 146, 148, 149, 171, 173, 174, 177, 198, 199, 200, 201, 202, 205, 226, 227, 229, 230, 233, 239, 253, 254, 255, 256, 257, 258, 260, 261, 263, 264, 265, 267, 282, 283, 284, 285, 286, 289, 310, 311, 312, 313, 314, 316, 317, 339, 340, 341, 342, 343, 344, 345, 366, 367, 368, 369, 370, 372, 373 |
| 3D-footprint Homologues: | 6jnm_A, 7w1m_H, 6u9q_A, 4x9j_A, 8ssu_A, 1f2i_J, 5kl3_A, 1llm_D, 8ssq_A, 7y3m_I, 2kmk_A, 1tf6_A, 4m9v_C, 7ysf_A, 7n5w_A, 5yj3_D, 2lt7_A, 5v3j_F, 2drp_D, 1tf3_A, 6e94_A, 8gn3_A, 6ml4_A, 5yel_A, 6blw_A, 5kkq_D, 5ei9_F, 7txc_E, 6a57_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 2gli_A, 1g2f_F, 5k5i_A, 3uk3_C, 5k5l_F, 8h9h_G, 2wbs_A |
| Binding Motifs: | ZNF250_2 cyagGCcyAc ZNF250_methyl_1 rTAGGCCTAy |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.