Transcription Factor

Accessions: ZNF250 (HT-SELEX2 May2017)
Names: ENSG00000196150, ZNF250
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3b0, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0
Length: 380
Pfam Domains: 20-42 Zinc finger, C2H2 type
21-42 C2H2-type zinc finger
34-58 Zinc-finger double domain
48-68 C2H2-type zinc finger
48-70 Zinc finger, C2H2 type
48-70 C2H2-type zinc finger
63-85 Zinc-finger double domain
75-86 C2H2-type zinc finger
76-98 Zinc finger, C2H2 type
76-95 C2H2-type zinc finger
91-115 Zinc-finger double domain
103-124 C2H2-type zinc finger
104-126 Zinc finger, C2H2 type
104-126 C2H2-type zinc finger
119-143 Zinc-finger double domain
132-154 C2H2-type zinc finger
132-154 Zinc finger, C2H2 type
132-154 C2H2-type zinc finger
147-170 Zinc-finger double domain
159-178 C2H2-type zinc finger
160-182 C2H2-type zinc finger
160-182 Zinc finger, C2H2 type
175-198 Zinc-finger double domain
187-206 C2H2-type zinc finger
188-210 Zinc finger, C2H2 type
188-210 C2H2-type zinc finger
204-227 Zinc-finger double domain
215-234 C2H2-type zinc finger
216-238 Zinc finger, C2H2 type
216-238 C2H2-type zinc finger
231-254 Zinc-finger double domain
244-266 Zinc finger, C2H2 type
244-266 C2H2-type zinc finger
244-266 C2H2-type zinc finger
259-282 Zinc-finger double domain
272-290 C2H2-type zinc finger
272-294 Zinc finger, C2H2 type
272-294 C2H2-type zinc finger
287-310 Zinc-finger double domain
300-322 C2H2-type zinc finger
300-322 Zinc finger, C2H2 type
300-322 C2H2-type zinc finger
317-338 Zinc-finger double domain
327-348 C2H2-type zinc finger
328-350 Zinc finger, C2H2 type
328-350 C2H2-type zinc finger
344-366 Zinc-finger double domain
355-380 C2H2-type zinc finger
356-378 Zinc finger, C2H2 type
356-378 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 LSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSVCGKAFSQS 60
61 SVLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHECLECRKAFTQLSHLI 120
121 QHQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCNECGKTFSVKRTLLQHQR 180
181 IHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECSECGKTFSHRSTLMNHERIHTE 240
241 EKPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCGECGHAFSARRSLIQHERIHTGEKPF 300
301 QCTECGKAFSLKATLIVHLRTHTGEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECGE 360
361 CGRAFNQHGHLIQHQKVHRK
Interface Residues: 30, 31, 33, 34, 37, 41, 48, 58, 59, 60, 61, 62, 65, 66, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 114, 115, 116, 117, 118, 120, 121, 124, 142, 143, 144, 145, 146, 148, 149, 171, 173, 174, 177, 198, 199, 200, 201, 202, 205, 226, 227, 229, 230, 233, 239, 253, 254, 255, 256, 257, 258, 260, 261, 263, 264, 265, 267, 282, 283, 284, 285, 286, 289, 310, 311, 312, 313, 314, 316, 317, 339, 340, 341, 342, 343, 344, 345, 366, 367, 368, 369, 370, 372, 373
3D-footprint Homologues: 6jnm_A, 7w1m_H, 6u9q_A, 4x9j_A, 8ssu_A, 1f2i_J, 5kl3_A, 1llm_D, 8ssq_A, 7y3m_I, 2kmk_A, 1tf6_A, 4m9v_C, 7ysf_A, 7n5w_A, 5yj3_D, 2lt7_A, 5v3j_F, 2drp_D, 1tf3_A, 6e94_A, 8gn3_A, 6ml4_A, 5yel_A, 6blw_A, 5kkq_D, 5ei9_F, 7txc_E, 6a57_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 2gli_A, 1g2f_F, 5k5i_A, 3uk3_C, 5k5l_F, 8h9h_G, 2wbs_A
Binding Motifs: ZNF250_2 cyagGCcyAc
ZNF250_methyl_1 rTAGGCCTAy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.