Transcription Factor

Accessions: MAX_MOUSE (HOCOMOCO 10), P28574 (JASPAR 2024)
Names: MAX_MOUSE, Myc-associated factor X, Myc-binding novel HLH/LZ protein, Protein max, Protein myn
Organisms: Mus musculus
Libraries: HOCOMOCO 10 1, JASPAR 2024 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 160
Pfam Domains: 24-74 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MSDNDDIEVESDEEQARFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR 60
61 AQILDKATEYIQYMRRKNDTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN 120
121 SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
Interface Residues: 25, 27, 28, 29, 31, 32, 35, 36, 40, 60
3D-footprint Homologues: 1a0a_B, 8osb_B, 7z5k_B, 1an4_A, 1am9_A, 7ssa_L, 5i50_B, 8hov_A, 7d8t_A, 7xi3_A, 5nj8_D, 8ia3_B, 7f2f_B, 5eyo_A, 7xq5_A, 5v0l_A, 7rcu_E, 5gnj_I, 6g1l_A
Binding Motifs: PB0147.1 ktGyCAyGcGaCdk
MAX_MOUSE.H10MO.A|M01200 smsCACGTGgc
PB0043.1 kgmsCACGTGgkcrkk
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.