Transcription Factor
| Accessions: | SRF_TF1 (HumanTF2 1.0), SRF_TF2 (HumanTF2 1.0), SRF (HT-SELEX2 May2017) |
| Names: | Serum response factor, SRF, SRF_HUMAN, ENSG00000112658 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P11831 |
| Notes: | Ensembl ID: ENSG00000112658; Construct type: TF1(SBP); TF family: MADS; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000112658; Construct type: TF2(3xFLAG); TF family: MADS; Clone source: Jolma et al. 2013, TF family: MADS experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: MADS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 120 |
| Pfam Domains: | 27-77 SRF-type transcription factor (DNA-binding and dimerisation domain) |
| Sequence: (in bold interface residues) | 1 GYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQ 60 61 VLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFE 120 |
| Interface Residues: | 18, 21, 22, 33, 36, 37, 41 |
| 3D-footprint Homologues: | 1hbx_A, 7x1n_C, 1n6j_A, 1c7u_A, 1mnm_A |
| Binding Motifs: | CUX1_SRF rCCwTAyAwGGtmrkrATCrATw RFX3_SRF trGcAACswykaCCwwatawGGt SRF_2 CCwTgTAwGG SRF_methyl_1 CCaTgTAtGG |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.