Transcription Factor

Accessions: SRF_TF1 (HumanTF2 1.0), SRF_TF2 (HumanTF2 1.0), SRF (HT-SELEX2 May2017)
Names: Serum response factor, SRF, SRF_HUMAN, ENSG00000112658
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P11831
Notes: Ensembl ID: ENSG00000112658; Construct type: TF1(SBP); TF family: MADS; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000112658; Construct type: TF2(3xFLAG); TF family: MADS; Clone source: Jolma et al. 2013, TF family: MADS experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: MADS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 120
Pfam Domains: 27-77 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 GYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQ 60
61 VLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFE 120
Interface Residues: 18, 21, 22, 33, 36, 37, 41
3D-footprint Homologues: 1hbx_A, 1egw_B, 7xuz_H, 8q9r_F, 8q9n_B, 8q9p_B, 1c7u_A, 1n6j_A, 8q9q_A, 1mnm_A
Binding Motifs: CUX1_SRF rCCwTAyAwGGtmrkrATCrATw
RFX3_SRF trGcAACswykaCCwwatawGGt
SRF_2 CCwTgTAwGG
SRF_methyl_1 CCaTgTAtGG
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.