Transcription Factor

						

			
Accessions: 1gat_A (3D-footprint 20231221), 1gau_A (3D-footprint 20231221)

			
Names: Eryf1, ERYTHROID TRANSCRIPTION FACTOR GATA-1, GATA-binding factor 1, GATA1_CHICK, NF-E1 DNA-binding protein, NF-E1a
Organisms: Gallus gallus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17678
Length: 60
Pfam Domains:      7-40 GATA zinc finger
Sequence: 
(in bold interface residues)		   1 KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS   60
Interface Residues: 16, 17, 19, 29, 33, 34, 37, 54, 56, 57
3D-footprint Homologues: 1gat_A, 3dfx_B, 4gat_A, 3vd6_C
Binding Motifs: 1gat_A AGATA
1gau_A aGATa
Binding Sites: 1gat_B / 1gau_B
1gat_C / 1gau_C
			
Publications: Omichinski J. G., Clore G. M., Schaad O., Felsenfeld G., Trainor C., Appella E., Stahl S. J., Gronenborn A. M. NMR structure of a specific DNA complex of Zn-containing DNA binding domain of GATA-1.. Science 261:438-446 (1993). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.