Transcription Factor
Accessions: | 1gat_A (3D-footprint 20231221), 1gau_A (3D-footprint 20231221) |
Names: | Eryf1, ERYTHROID TRANSCRIPTION FACTOR GATA-1, GATA-binding factor 1, GATA1_CHICK, NF-E1 DNA-binding protein, NF-E1a |
Organisms: | Gallus gallus |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P17678 |
Length: | 60 |
Pfam Domains: | 7-40 GATA zinc finger |
Sequence: (in bold interface residues) | 1 KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS 60 |
Interface Residues: | 16, 17, 19, 29, 33, 34, 37, 54, 56, 57 |
3D-footprint Homologues: | 1gat_A, 3dfx_B, 4gat_A, 3vd6_C |
Binding Motifs: | 1gat_A AGATA 1gau_A aGATa |
Binding Sites: | 1gat_B / 1gau_B 1gat_C / 1gau_C |
Publications: | Omichinski J. G., Clore G. M., Schaad O., Felsenfeld G., Trainor C., Appella E., Stahl S. J., Gronenborn A. M. NMR structure of a specific DNA complex of Zn-containing DNA binding domain of GATA-1.. Science 261:438-446 (1993). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.