Transcription Factor

Accessions: TCF3_DBD (HumanTF 1.0), TCF3_TF2 (HumanTF2 1.0)
Names: HMG box transcription factor 3, TCF-3, TCF3, TF7L1_HUMAN, Transcription factor 7-like 1, bHLHb21, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, TFE2_HUMAN, Transcription factor 3, Transcription factor E2-alpha, Transcription factor ITF-1
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: Q9HCS4
Notes: Ensembl ID: ENSG00000071564; DNA-binding domain sequence; TF family: bHLH; Clone source: Gene synthesis, Ensembl ID: ENSG00000071564; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013
Length: 172
Pfam Domains: 71-123 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 SRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLS 60
61 LEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVI 120
121 LGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPA
Interface Residues: 72, 76, 78, 79, 82
3D-footprint Homologues: 8osb_B, 7z5k_B
Binding Motifs: TCF3_DBD mrCACCTGbd
ETV2_TCF3 CAssTGmacCGGAwrys
ETV5_TCF3_1 CAsGTGsrscGGAagkg
ETV5_TCF3_2 gscGGAwgkgggrCASsTGk
FLI1_TCF3 rCCGGAwrCAssTgy
HOXB2_TCF3_1 vCACCTGcmmcymATyA
HOXB2_TCF3_2 rCAssTGyrrsymATTA
TEAD4_TCF3 rCAGsTGmGwATkyr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.