Transcription Factor
| Accessions: | TCF3_DBD (HumanTF 1.0), TCF3_TF2 (HumanTF2 1.0) |
| Names: | HMG box transcription factor 3, TCF-3, TCF3, TF7L1_HUMAN, Transcription factor 7-like 1, bHLHb21, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, TFE2_HUMAN, Transcription factor 3, Transcription factor E2-alpha, Transcription factor ITF-1 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Uniprot: | Q9HCS4 |
| Notes: | Ensembl ID: ENSG00000071564; DNA-binding domain sequence; TF family: bHLH; Clone source: Gene synthesis, Ensembl ID: ENSG00000071564; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013 |
| Length: | 172 |
| Pfam Domains: | 71-123 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 SRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLS 60 61 LEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVI 120 121 LGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPA |
| Interface Residues: | 72, 75, 76, 78, 79, 80, 82, 83 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 6od3_F, 2ypa_B, 2ql2_A, 2ql2_D |
| Binding Motifs: | TCF3_DBD mrCACCTGbd ETV2_TCF3 CAssTGmacCGGAwrys ETV5_TCF3_1 CAsGTGsrscGGAagkg ETV5_TCF3_2 gscGGAwgkgggrCASsTGk FLI1_TCF3 rCCGGAwrCAssTgy HOXB2_TCF3_1 vCACCTGcmmcymATyA HOXB2_TCF3_2 rCAssTGyrrsymATTA TEAD4_TCF3 rCAGsTGmGwATkyr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.