Transcription Factor

Accessions: BATF3_DBD (HumanTF 1.0), BATF3 (HT-SELEX2 May2017)
Names: 21 kDa small nuclear factor isolated from T-cells, B-ATF-3, Basic leucine zipper transcriptional factor ATF-like 3, BATF3, BATF3_HUMAN, Jun dimerization protein p21SNFT, ENSG00000123685
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9NR55
Notes: Ensembl ID: ENSG00000123685; DNA-binding domain sequence; TF family: bZIP; Clone source: Megaman, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 112
Pfam Domains: 31-91 bZIP transcription factor
32-85 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 QGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADK 60
61 LHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPV
Interface Residues: 39, 40, 42, 43, 44, 46, 47, 48, 50, 51, 52, 54, 56
3D-footprint Homologues: 7x5e_F, 1skn_P, 4eot_A, 6mg1_B, 5t2h_A, 8k8c_A, 2c9l_Z, 5vpe_D, 1dh3_C, 5t01_B
Binding Motifs: BATF3_DBD TGATGACGTCATCr
BATF3_2 grTGACGTCAyc
BATF3_4 grTGACGTCAys
BATF3_methyl_1 gaTGAyGTCAyc
BATF3_methyl_3 grTGAyGTCAyc
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.