Transcription Factor
| Accessions: | 1per_L (3D-footprint 20250804), 1per_R (3D-footprint 20250804), 1rpe_L (3D-footprint 20250804), 1rpe_R (3D-footprint 20250804), 2or1_L (3D-footprint 20250804), 2or1_R (3D-footprint 20250804) |
| Names: | 434 REPRESSOR, Fragment, Repressor protein CI, RPC1_BP434 |
| Organisms: | Phage 434 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P16117 |
| Length: | 63 |
| Pfam Domains: | 4-62 Helix-turn-helix domain 4-57 Helix-turn-helix domain 6-59 Helix-turn-helix |
| Sequence: (in bold interface residues) | 1 SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLL 60 61 NGT |
| Interface Residues: | 17, 18, 27, 28, 29, 30, 32, 33, 36, 38, 39, 43 |
| 3D-footprint Homologues: | 3cro_R, 1per_L, 7jvt_D, 3bdn_A, 5k98_B, 3dnv_B, 6chv_D, 3zkc_A, 4z5h_A, 7tz1_A, 1rio_A |
| Binding Motifs: | 2or1_L TACAAnAnA 1per_L tACaA 1per_LR tACaAgwwarnvtGTa 1rpe_L TTTTT 1rpe_LR AAmAAgnnnnATTGTA 2or1_LR TACAAnnTnTnTTGTA |
| Binding Sites: | 1per_A 1per_B 1rpe_A 1rpe_B 2or1_A 2or1_B |
| Publications: | Rodgers D.W, Harrison S.C. The complex between phage 434 repressor DNA-binding domain and operator site OR3: structural differences between consensus and non-consensus half-sites. Structure (London, England : 1993) 1:227-40 (1993). [Pubmed] Shimon L.J, Harrison S.C. The phage 434 OR2/R1-69 complex at 2.5 A resolution. Journal of molecular biology 232:826-38 (1993). [Pubmed] Aggarwal A.K, Rodgers D.W, Drottar M, Ptashne M, Harrison S.C. Recognition of a DNA operator by the repressor of phage 434: a view at high resolution. Science (New York, N.Y.) 242:899-907 (1988). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.