Transcription Factor

Accessions: 1per_L (3D-footprint 20250804), 1per_R (3D-footprint 20250804), 1rpe_L (3D-footprint 20250804), 1rpe_R (3D-footprint 20250804), 2or1_L (3D-footprint 20250804), 2or1_R (3D-footprint 20250804)
Names: 434 REPRESSOR, Fragment, Repressor protein CI, RPC1_BP434
Organisms: Phage 434
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P16117
Length: 63
Pfam Domains: 4-62 Helix-turn-helix domain
4-57 Helix-turn-helix domain
6-59 Helix-turn-helix
Sequence:
(in bold interface residues)
1 SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLL 60
61 NGT
Interface Residues: 17, 18, 27, 28, 29, 30, 32, 33, 36, 38, 39, 43
3D-footprint Homologues: 3cro_R, 1per_L, 7jvt_D, 3bdn_A, 5k98_B, 3dnv_B, 6chv_D, 3zkc_A, 4z5h_A, 7tz1_A, 1rio_A
Binding Motifs: 2or1_L TACAAnAnA
1per_L tACaA
1per_LR tACaAgwwarnvtGTa
1rpe_L TTTTT
1rpe_LR AAmAAgnnnnATTGTA
2or1_LR TACAAnnTnTnTTGTA
Binding Sites: 1per_A
1per_B
1rpe_A
1rpe_B
2or1_A
2or1_B
Publications: Rodgers D.W, Harrison S.C. The complex between phage 434 repressor DNA-binding domain and operator site OR3: structural differences between consensus and non-consensus half-sites. Structure (London, England : 1993) 1:227-40 (1993). [Pubmed]

Shimon L.J, Harrison S.C. The phage 434 OR2/R1-69 complex at 2.5 A resolution. Journal of molecular biology 232:826-38 (1993). [Pubmed]

Aggarwal A.K, Rodgers D.W, Drottar M, Ptashne M, Harrison S.C. Recognition of a DNA operator by the repressor of phage 434: a view at high resolution. Science (New York, N.Y.) 242:899-907 (1988). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.