Transcription Factor
| Accessions: | Xre (DBTBS 1.0) |
| Names: | HTH-type transcriptional regulator Xre, Putative PBSX repressor, Xre, XRE_BACSU |
| Organisms: | Bacillus subtilis |
| Libraries: | DBTBS 1.0 1 1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed] |
| Uniprot: | P23789 |
| Length: | 113 |
| Pfam Domains: | 3-56 Helix-turn-helix domain 3-63 Helix-turn-helix domain 10-58 Helix-turn-helix 10-60 Cro/C1-type HTH DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MIGGRLKSLRGKRTQEEIASHIGVSRARYSHYENGRSEPDYDTLQKLADYFQVTTDYLLT 60 61 GKDKKSDDDMFSDPDLQLAYRDMQDFSPESKQQAIEFINYLKEKEKNRKPKNK |
| Interface Residues: | 15, 16, 25, 26, 27, 28, 30, 31, 34, 36, 37, 40 |
| 3D-footprint Homologues: | 2r1j_L, 3n97_A, 1per_L, 4z5h_A, 3dnv_B, 5k98_B, 6w1a_A, 6lty_B, 5j2y_A, 4jcy_A |
| Binding Motifs: | Xre GATACArAATGTATC |
| Binding Sites: | xkdB_1 xkdB_2 xre_1 xre_2 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.