Transcription Factor

Accessions: T037195_1.02 (CISBP 1.02)
Names: che-1, T037195_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 273
Pfam Domains: 166-186 C2H2-type zinc finger
166-188 C2H2-type zinc finger
166-188 Zinc finger, C2H2 type
180-204 Zinc-finger double domain
194-216 Zinc finger, C2H2 type
195-216 C2H2-type zinc finger
196-216 C2H2-type zinc finger
208-232 Zinc-finger double domain
222-244 C2H2-type zinc finger
222-244 Zinc finger, C2H2 type
222-244 C2H2-type zinc finger
237-260 Zinc-finger double domain
250-272 C2H2-type zinc finger
250-272 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MSYHYQMNNNNTDFFDSANYIPQMQMHHGYQDFYASDSTSSMPSSGTTQQALQQTENGII 60
61 QGQNGSDHGAYGGWRQHDWNSTSSWSIGNQLEMENGTLTMSHGATNDGNIRNNQQMMTSN 120
121 HITTDSFRQIPPSGLCYMDPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCGKAFSQAAN 180
181 LTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKH 240
241 LRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK
Interface Residues: 48, 49, 50, 51, 53, 54, 166, 176, 177, 178, 179, 180, 182, 183, 185, 186, 187, 189, 204, 205, 206, 207, 208, 210, 211, 212, 232, 233, 234, 235, 236, 237, 238, 239, 240, 260, 261, 262, 263, 264, 266, 267, 271
3D-footprint Homologues: 1per_L, 2kmk_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 2gli_A, 8ssu_A, 1g2f_F, 5kkq_D, 5ei9_F, 1llm_D, 5kl3_A, 1ubd_C, 6ml4_A, 5v3j_F, 8ssq_A, 1f2i_J, 7w1m_H, 6e94_A, 7ysf_A, 2jpa_A, 1tf3_A, 3uk3_C, 6u9q_A, 5yel_A, 4x9j_A, 2wbs_A, 1tf6_A, 6blw_A, 5k5l_F, 8h9h_G, 4m9v_C, 2lt7_A, 6a57_A, 8gn3_A, 7txc_E, 5k5i_A, 2drp_D, 7y3m_I, 5yj3_D
Binding Motifs: M0388_1.02 wagGGcTTCm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.