Transcription Factor

Accessions: Q07916 (JASPAR 2024)
Names: Octamer-binding transcription factor EMB, PO6F1_MOUSE, POU domain, class 6, transcription factor 1, Transcription regulatory protein MCP-1
Organisms: Mus musculus
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 301
Pfam Domains: 140-213 Pou domain - N-terminal to homeobox domain
235-290 Homeobox domain
Sequence:
(in bold interface residues)
1 MPGISSQILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLA 60
61 SSPLPQPVAVRKPNTPESPAKSEVQPIQPTQAVPQPAVILTSPTPALKPSAATPIPITCS 120
121 ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY 180
181 SQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTS 240
241 FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI 300
301 P
Interface Residues: 165, 166, 181, 182, 183, 184, 186, 187, 193, 197, 234, 235, 236, 237, 238, 239, 240, 276, 277, 279, 280, 283, 284, 287, 288, 291
3D-footprint Homologues: 7u0g_M, 3d1n_M, 3l1p_A, 4cja_A, 1e3o_C, 1au7_A, 1o4x_A, 7xrc_C, 8g87_X, 2xsd_C, 4j19_B, 1fjl_B, 6a8r_A, 3cmy_A, 2h1k_B, 1puf_A, 1ig7_A, 5zfz_A, 1zq3_P, 3lnq_A, 2lkx_A, 1nk2_P, 6es3_K, 1mnm_C, 7q3o_C, 2ld5_A, 4cyc_A, 3a01_E, 5hod_A, 1b72_A, 5jlw_D, 3rkq_B, 2r5y_A, 2hdd_A, 1puf_B, 1jgg_B, 4xrs_G, 1k61_B, 1le8_A, 5zjt_E, 4qtr_D, 1du0_A
Binding Motifs: PH0151.1 vwmswTAATKAGstkgm
PH0152.1 rhasATAATGAGstkkc
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.