Transcription Factor
Accessions: | BARHL2_DBD (HumanTF 1.0), BARHL2 (HT-SELEX2 May2017) |
Names: | BARH2_HUMAN, BARHL2, ENSG00000143032 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q9NY43 |
Notes: | Ensembl ID: ENSG00000143032; DNA-binding domain sequence; TF family: homeodomain; Clone source: Megaman, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 127 |
Pfam Domains: | 41-97 Homeobox domain |
Sequence: (in bold interface residues) | 1 TKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFE 60 61 RQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFP 120 121 SPYFYHP |
Interface Residues: | 41, 42, 43, 44, 58, 82, 83, 84, 85, 86, 87, 89, 90, 92, 93, 94, 97, 116 |
3D-footprint Homologues: | 5hod_A, 8ejp_B, 6a8r_A, 1fjl_B, 3cmy_A, 8pmf_A, 5zfz_A, 1puf_A, 1ig7_A, 3d1n_M, 1nk2_P, 1zq3_P, 2lkx_A, 6m3d_C, 2ld5_A, 7q3o_C, 6es3_K, 4cyc_A, 8ik5_C, 1jgg_B, 7psx_B, 3a01_E, 8osb_E, 1au7_A, 5jlw_D, 3lnq_A, 8eml_B, 4xrs_G, 2hdd_A, 1b72_A, 3rkq_B, 2r5y_A, 5flv_I, 2hos_A, 9b8u_A, 5zjt_E, 3knt_A, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 1puf_B, 4qtr_D, 1k61_B, 1o4x_A, 8g87_X, 1mnm_C, 8bx1_A, 1du0_A |
Binding Motifs: | BARHL2_DBD_1 vhTAAAyGgt BARHL2_DBD_2 syTAAwtGcy BARHL2_DBD_3 TAAwyGsysyTAAwyg BARHL2_2 yTAAAYGgt BARHL2_3 yTAAtTGsy BARHL2_5 cTAAAYGg BARHL2_6 cTAAttGc BARHL2_methyl_1 cTAAtTGsy BARHL2_methyl_4 cTAATTGs |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.