Transcription Factor

Accessions: 1ozj_B (3D-footprint 20241219)
Names: hMAD-3, hSMAD3, JV15-2, MAD homolog 3, Mothers against decapentaplegic homolog 3, Mothers against DPP homolog 3, SMAD 3, SMAD family member 3, SMAD3_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P84022
Length: 124
Pfam Domains: 23-123 MH1 domain
Sequence:
(in bold interface residues)
1 PPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIP 60
61 RSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQ 120
121 RVET
Interface Residues: 23, 25, 29, 68, 69, 72
3D-footprint Homologues: 8cli_A, 8k4l_B
Binding Motifs: 1ozj_AB GtCTAGaCA
1ozj_B AGaC
Binding Sites: 1ozj_C
1ozj_D
Publications: Chai J, Wu J.W, Yan N, Massagué J, Pavletich N.P, Shi Y. Features of a Smad3 MH1-DNA complex. Roles of water and zinc in DNA binding. The Journal of biological chemistry 278:20327-31 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.