Transcription Factor

Accessions: MEF2D_DBD (HumanTF 1.0), MEF2D (HT-SELEX2 May2017)
Names: MEF2D, Q05BX2_HUMAN, ENSG00000116604
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q05BX2
Notes: Ensembl ID: ENSG00000116604; DNA-binding domain sequence; TF family: MADS; Clone source: MGC, TF family: MADS experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: MADS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 112
Pfam Domains: 8-57 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 RKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDM 60
61 DKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLE
Interface Residues: 1, 2, 13, 16, 17, 21, 55, 66, 91
3D-footprint Homologues: 8q9r_F, 8q9n_B, 1c7u_A, 1n6j_A, 8q9p_B, 1egw_B, 7xuz_H, 8q9q_A, 1hbx_A, 1mnm_A, 7yq3_E
Binding Motifs: MEF2D_DBD dCTAwAAATAGm
MEF2D_2 CCwwATwtrG
MEF2D_methyl_1 CCwwATwtrG
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.