Transcription Factor
| Accessions: | 4r2q_A (3D-footprint 20250804), 4r2r_A (3D-footprint 20250804) |
| Names: | Wilms tumor protein, isoform 4/CRA_a, WT1_HUMAN, WT33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19544 |
| Length: | 88 |
| Pfam Domains: | 5-29 C2H2-type zinc finger 5-29 Zinc finger, C2H2 type 22-46 Zinc-finger double domain 35-55 Zinc-finger of C2H2 type 35-57 C2H2-type zinc finger 35-57 Zinc finger, C2H2 type 49-75 Zinc-finger double domain 63-87 Zinc finger, C2H2 type 63-85 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGE 60 61 KPFSCRWPSCQKKFARSDELVRHHNMHQ |
| Interface Residues: | 17, 18, 19, 20, 21, 23, 24, 45, 46, 47, 48, 49, 51, 52, 53, 56, 71, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83 |
| 3D-footprint Homologues: | 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 5ei9_F, 2jpa_A, 1g2f_F, 7ysf_A, 6ml4_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 2drp_D, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 2wbs_A, 1tf6_A, 5v3j_F, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 8gn3_A, 3uk3_C, 7txc_E, 1llm_D, 5yel_A, 5yj3_D, 4m9v_C |
| Binding Motifs: | 4r2q_A aGCCCACGC 4r2r_A AGCCCACGC |
| Binding Sites: | 4r2q_B / 4r2r_B 4r2q_C / 4r2r_C |
| Publications: | Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.