Transcription Factor

Accessions: 4r2q_A (3D-footprint 20260701), 4r2r_A (3D-footprint 20260701)
Names: Wilms tumor protein, isoform 4/CRA_a, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 88
Pfam Domains: 5-29 C2H2-type zinc finger
5-29 Zinc finger, C2H2 type
22-46 Zinc-finger double domain
35-57 C2H2-type zinc finger
35-57 Zinc finger, C2H2 type
35-55 Zinc-finger of C2H2 type
49-75 Zinc-finger double domain
63-85 C2H2-type zinc finger
63-87 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGE 60
61 KPFSCRWPSCQKKFARSDELVRHHNMHQ
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 45, 46, 47, 48, 49, 51, 52, 53, 56, 71, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83
3D-footprint Homologues: 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 2drp_D, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 2wbs_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 7ysf_A, 6ml4_A, 1ubd_C, 8ssq_A, 7w1m_H, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 8gn3_A, 3uk3_C, 1llm_D, 5yel_A, 5yj3_D, 7txc_E, 4m9v_C
Binding Motifs: 4r2q_A aGCCCACGC
4r2r_A AGCCCACGC
Binding Sites: 4r2q_B / 4r2r_B
4r2q_C / 4r2r_C
Publications: Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.