Transcription Factor

Accessions: 6jpi_C (3D-footprint 20260701)
Names: HTH cro/C1-type domain-containing protein, Q9HVC1_PSEAE
Organisms: Pseudomonas aeruginosa, strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9HVC1
Length: 91
Pfam Domains: 16-63 Helix-turn-helix
Sequence:
(in bold interface residues)
1 RPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDTS 60
61 AQFWMNLQSEYSLATAYAANGKQIEHEIEPL
Interface Residues: 22, 31, 32, 33, 34, 36, 37, 43
3D-footprint Homologues: 6chv_D, 6fix_D, 7csw_B
Binding Motifs: 6jpi_ABCD TAACCnTTnACGTTAnnCGTTA
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.