Transcription Factor

						

			
Accessions: 1lcc_A (3D-footprint 20231221), 1lcd_A (3D-footprint 20231221)

			
Names: Lac Repressor, LACI_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03023
Length: 51
Pfam Domains:      5-50 Bacterial regulatory proteins, lacI family
Sequence: 
(in bold interface residues)		   1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
Interface Residues: 6, 7, 16, 17, 18, 19, 21, 22, 28, 29, 30
3D-footprint Homologues: 1efa_B, 3n97_A, 7ce1_D, 3oqm_C, 5ui5_I, 1l1m_B, 1zvv_A, 1jft_A, 4i2o_B
Binding Motifs: 1lcc_A TTGTGAGC
1lcd_A TnGTGAG
Binding Sites: 1lcc_B / 1lcd_B
1lcc_C / 1lcd_C
			
Publications: Chuprina V.P, Rullmann J.A, Lamerichs R.M, van Boom J.H, Boelens R, Kaptein R. Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics. Journal of molecular biology 234:446-62 (1993). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.