Transcription Factor
| Accessions: | 5hlg_C (3D-footprint 20231221) |
| Names: | MarR family transcriptional regulator, Q5HKZ1_STAEQ |
| Organisms: | Staphylococcus epidermidis, strain ATCC 35984 / RP62A |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q5HKZ1 |
| Length: | 134 |
| Pfam Domains: | 28-85 Sugar-specific transcriptional regulator TrmB 32-90 MarR family 33-99 Winged helix DNA-binding domain 33-90 MarR family 38-106 HxlR-like helix-turn-helix 46-87 FeoC like transcriptional regulator 56-102 Transcriptional regulator PadR-like family |
| Sequence: (in bold interface residues) | 1 EQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLD 60 61 LSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLYDETKY 120 121 VFEELEQTLKHLIE |
| Interface Residues: | 53, 62, 63, 64, 65, 67, 68, 69, 71, 72, 89 |
| 3D-footprint Homologues: | 7el3_B, 3q5f_A, 6jbx_A, 4lln_I, 7dvv_A, 5yi2_J, 5h3r_A, 1z9c_A, 6c2s_C, 5hlg_E, 3zpl_B, 5f7q_C, 4aik_A, 4fx4_B, 5hso_A |
| Binding Motifs: | 5hlg_AC CGATTnAGnnnncTnaATCG |
| Binding Sites: | 5hlg_K 5hlg_L |
| Publications: | Liu G, Liu X, Xu H, Liu X, Zhou H, Huang Z, Gan J, Chen H, Lan L, Yang CG. Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR. J Am Chem Soc 139:1598-1608 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.