Transcription Factor

						

			
Accessions: 3igm_A (3D-footprint 20231221)

			
Names: PF14_0633 protein, Q8IKH2_PLAF7
Organisms: isolate 3D7, Plasmodium falciparum
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8IKH2
Length: 56
Pfam Domains:      3-54 AP2 domain
Sequence: 
(in bold interface residues)		   1 MSSGYPGVSWNKRMCAWLAFFYDGASRRSRTFHPKHFNMDKEKARLAAVEFMKTVE
Interface Residues: 27, 28, 29, 31, 32, 33, 35, 37, 38, 43, 45, 49, 51
3D-footprint Homologues: 6crm_A, 2xe0_A, 2xe0_B, 3mxa_A
Binding Motifs: 3igm_A tGCaTGC
Binding Sites: 3igm_C
3igm_D
			
Publications: Lindner S.E, De Silva E.K, Keck J.L, Llinás M. Structural determinants of DNA binding by a P. falciparum ApiAP2 transcriptional regulator. Journal of molecular biology 395:558-67 (2010). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.