Transcription Factor

						

			
Accessions: 5dui_B (3D-footprint 20231221)

			
Names: Forkhead box protein O1, Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q12778
Length: 85
Pfam Domains:      3-82 Fork head domain
Sequence: 
(in bold interface residues)		   1 GNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLH   60
  61 SKFIRVQNEGTGKSSWWMLNPEGGK
Interface Residues: 45, 48, 50, 51, 52, 54, 55, 56, 58, 59, 68, 73
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3qrf_G
Binding Motifs: 5dui_AB TtnnnnnnnnnnnTAAA
Binding Sites: 5dui_C
5dui_D
			
Publications: Singh P, Han EH, Endrizzi JA, O'Brien RM, Chi YI. Crystal structures reveal a new and novel FoxO1 binding site within the human glucose-6-phosphatase catalytic subunit 1 gene promoter. J Struct Biol 198:54-64 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.