Transcription Factor
| Accessions: | 5dui_B (3D-footprint 20250804) |
| Names: | Forkhead box protein O1, Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q12778 |
| Length: | 85 |
| Pfam Domains: | 3-82 Fork head domain |
| Sequence: (in bold interface residues) | 1 GNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLH 60 61 SKFIRVQNEGTGKSSWWMLNPEGGK |
| Interface Residues: | 23, 45, 47, 48, 50, 51, 52, 54, 55, 56, 58, 59, 68, 73 |
| 3D-footprint Homologues: | 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 8sro_B, 3qrf_G |
| Binding Motifs: | 5dui_AB TtnnnnnnnnnnnTAAA |
| Binding Sites: | 5dui_C 5dui_D |
| Publications: | Singh P, Han EH, Endrizzi JA, O'Brien RM, Chi YI. Crystal structures reveal a new and novel FoxO1 binding site within the human glucose-6-phosphatase catalytic subunit 1 gene promoter. J Struct Biol 198:54-64 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.