Transcription Factor
| Accessions: | 1lo1_A (3D-footprint 20250804) |
| Names: | ERR beta-2, ERR-beta, ERR2_HUMAN, Estrogen receptor-like 2, Estrogen-related receptor beta, Nuclear receptor subfamily 3 group B member 2, Steroid hormone receptor ERR2 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O95718 |
| Length: | 90 |
| Pfam Domains: | 6-74 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ 60 61 ACRFMKALKVGMLKEGVRLDRVRGGRQKYK |
| Interface Residues: | 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57, 79, 81, 83, 86 |
| 3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A |
| Binding Motifs: | 1lo1_A tnACCTnGAg |
| Binding Sites: | 1lo1_B 1lo1_C |
| Publications: | Gearhart M.D, Holmbeck S.M, Evans R.M, Dyson H.J, Wright P.E. Monomeric complex of human orphan estrogen related receptor-2 with DNA: a pseudo-dimer interface mediates extended half-site recognition. Journal of molecular biology 327:819-32 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.