Transcription Factor

Accessions: 1lo1_A (3D-footprint 20241219)
Names: ERR beta-2, ERR-beta, ERR2_HUMAN, Estrogen receptor-like 2, Estrogen-related receptor beta, Nuclear receptor subfamily 3 group B member 2, Steroid hormone receptor ERR2
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O95718
Length: 90
Pfam Domains: 6-74 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ 60
61 ACRFMKALKVGMLKEGVRLDRVRGGRQKYK
Interface Residues: 16, 18, 25, 28, 29, 32, 33, 57, 79, 81, 83, 86
3D-footprint Homologues: 7wnh_D, 6l6q_B, 3g9m_B, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A
Binding Motifs: 1lo1_A tnACCTnGAg
Binding Sites: 1lo1_B
1lo1_C
Publications: Gearhart M.D, Holmbeck S.M, Evans R.M, Dyson H.J, Wright P.E. Monomeric complex of human orphan estrogen related receptor-2 with DNA: a pseudo-dimer interface mediates extended half-site recognition. Journal of molecular biology 327:819-32 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.