Transcription Factor

Accessions: T044225_1.02 (CISBP 1.02)
Names: T044225_1.02;, ZIC2
Organisms: Homo sapiens
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: family:C2H2 ZF
Length: 162
Pfam Domains: 21-40 Zinc finger, C2H2 type
22-40 C2H2-type zinc finger
51-76 Zinc finger, C2H2 type
55-76 C2H2-type zinc finger
69-94 Zinc-finger double domain
82-106 Zinc finger, C2H2 type
82-106 C2H2-type zinc finger
98-125 Zinc-finger double domain
112-136 Zinc finger, C2H2 type
112-136 C2H2-type zinc finger
130-153 Zinc-finger double domain
142-162 Zinc finger, C2H2 type
142-162 C2H2-type zinc finger
143-162 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 PPPPPPPPAPPPPPPLNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREG 60
61 KPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCD 120
121 RRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMK
Interface Residues: 27, 28, 30, 31, 34, 64, 65, 66, 67, 68, 70, 71, 75, 82, 94, 95, 96, 97, 98, 100, 101, 102, 103, 104, 107, 124, 125, 126, 127, 128, 129, 130, 131, 132, 135, 152, 153, 154, 155, 156, 158, 159
3D-footprint Homologues: 5v3j_F, 7w1m_H, 5yel_A, 1ubd_C, 8cuc_F, 1tf3_A, 7n5w_A, 5ei9_F, 1g2f_F, 6ml4_A, 8ssq_A, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 1tf6_A, 8h9h_G, 7ysf_A, 5k5i_A, 6e94_A, 8gn3_A, 2lt7_A, 2kmk_A, 3uk3_C, 7y3l_A, 6jnm_A, 6blw_A, 1llm_D, 6u9q_A, 1f2i_J, 5kl3_A, 7txc_E, 4m9v_C, 7y3m_I, 6a57_A, 2jpa_A, 5yj3_D, 2wbs_A, 2drp_D
Binding Motifs: M4148_1.02 kgGGtGGTc
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.