Transcription Factor
| Accessions: | T044225_1.02 (CISBP 1.02) |
| Names: | T044225_1.02;, ZIC2 |
| Organisms: | Homo sapiens |
| Libraries: | CISBP 1.02 1 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Notes: | family:C2H2 ZF |
| Length: | 162 |
| Pfam Domains: | 21-40 Zinc finger, C2H2 type 22-40 C2H2-type zinc finger 51-76 Zinc finger, C2H2 type 55-76 C2H2-type zinc finger 69-94 Zinc-finger double domain 82-106 Zinc finger, C2H2 type 82-106 C2H2-type zinc finger 98-125 Zinc-finger double domain 112-136 C2H2-type zinc finger 112-136 Zinc finger, C2H2 type 130-153 Zinc-finger double domain 142-162 Zinc finger, C2H2 type 142-162 C2H2-type zinc finger 143-162 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 PPPPPPPPAPPPPPPLNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREG 60 61 KPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCD 120 121 RRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMK |
| Interface Residues: | 27, 28, 30, 31, 34, 64, 65, 66, 67, 68, 70, 71, 75, 82, 94, 95, 96, 97, 98, 100, 101, 102, 103, 104, 107, 124, 125, 126, 127, 128, 129, 130, 131, 132, 135, 152, 153, 154, 155, 156, 158, 159 |
| 3D-footprint Homologues: | 5v3j_F, 7w1m_H, 5yel_A, 1ubd_C, 8cuc_F, 1tf3_A, 7n5w_A, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 1tf6_A, 5ei9_F, 1g2f_F, 6ml4_A, 8ssq_A, 8h9h_G, 5k5i_A, 6e94_A, 8gn3_A, 7ysf_A, 2lt7_A, 2kmk_A, 7y3l_A, 6jnm_A, 3uk3_C, 6blw_A, 1llm_D, 6u9q_A, 1f2i_J, 5kl3_A, 7txc_E, 4m9v_C, 7y3m_I, 6a57_A, 2jpa_A, 5yj3_D, 2wbs_A, 2drp_D |
| Binding Motifs: | M4148_1.02 kgGGtGGTc |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.