Transcription Factor
Accessions: | Q04741 (JASPAR 2024) |
Names: | Empty spiracles homolog 1, Empty spiracles-like protein 1, EMX1_HUMAN, Homeobox protein EMX1 |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q04741 |
Length: | 257 |
Pfam Domains: | 160-216 Homeobox domain |
Sequence: (in bold interface residues) | 1 MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEA 60 61 AFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHR 120 121 DPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEK 180 181 NHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWR 240 241 IATKQANGEDIDVTSND |
Interface Residues: | 157, 160, 161, 162, 163, 201, 202, 204, 205, 208, 209, 212, 213, 216, 227, 230 |
3D-footprint Homologues: | 1ig7_A, 1puf_A, 3cmy_A, 6a8r_A, 3d1n_M, 1fjl_B, 5zfz_A, 2h1k_B, 1jgg_B, 1nk2_P, 1zq3_P, 6m3d_C, 3lnq_A, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 5zjt_E, 2hdd_A, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 1au7_A, 2hos_A, 5jlw_D, 4cyc_A, 1b72_A, 4xrs_G, 3a01_E, 5flv_I, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 8g87_X, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B, 4xrm_B, 3l1p_A, 1o4x_A, 1le8_B, 1du0_A, 4j19_B |
Binding Motifs: | MA0612.1 vyTAATkAsy MA0612.2 sTAATTAs MA0612.3 TAATTA |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.