Transcription Factor

Accessions: TBX19_DBD (HumanTF 1.0), TBX19 (HT-SELEX2 May2017)
Names: T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBX19, TBX19_HUMAN, ENSG00000143178
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: O60806
Notes: Ensembl ID: ENSG00000143178; DNA-binding domain sequence; TF family: T-box; Clone source: Gene synthesis, TF family: T_box experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: T_box experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 221
Pfam Domains: 22-197 T-box
Sequence:
(in bold interface residues)
1 VVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGL 60
61 DPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPIS 120
121 FSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEE 180
181 ITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSH
Interface Residues: 47, 174, 175, 191, 194, 195
3D-footprint Homologues: 4a04_B, 1h6f_B, 5flv_I, 1xbr_B, 6f59_B, 2x6v_A
Binding Motifs: TBX19_DBD wtTmrCACcTAgGTGygAaa
TBX19_2 rAsGTGykAmwkTsrCACCTy
TBX19_methyl_1 wAcGTGtkAawtTmaCACcTh
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.