Transcription Factor
Accessions: | TBX19_DBD (HumanTF 1.0), TBX19 (HT-SELEX2 May2017) |
Names: | T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBX19, TBX19_HUMAN, ENSG00000143178 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | O60806 |
Notes: | Ensembl ID: ENSG00000143178; DNA-binding domain sequence; TF family: T-box; Clone source: Gene synthesis, TF family: T_box experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: T_box experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4 |
Length: | 221 |
Pfam Domains: | 22-197 T-box |
Sequence: (in bold interface residues) | 1 VVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGL 60 61 DPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPIS 120 121 FSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEE 180 181 ITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSH |
Interface Residues: | 47, 174, 175, 191, 194, 195 |
3D-footprint Homologues: | 4a04_B, 1h6f_B, 5flv_I, 1xbr_B, 6f59_B, 2x6v_A |
Binding Motifs: | TBX19_DBD wtTmrCACcTAgGTGygAaa TBX19_2 rAsGTGykAmwkTsrCACCTy TBX19_methyl_1 wAcGTGtkAawtTmaCACcTh |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.