Transcription Factor

Accessions: peb-F5-7 (FlyZincFinger 1.0 )
Names: CG12212
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 175
Pfam Domains: 2-24 C2H2-type zinc finger
34-56 Zinc finger, C2H2 type
34-56 C2H2-type zinc finger
34-52 Zinc-finger of C2H2 type
48-73 Zinc-finger double domain
62-84 Zinc finger, C2H2 type
62-84 C2H2-type zinc finger
87-105 C2H2-type zinc finger
119-141 Zinc finger, C2H2 type
119-142 C2H2-type zinc finger
133-158 Zinc-finger double domain
147-170 Zinc finger, C2H2 type
147-170 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KYLCPICEVVSATPHEFTNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGER 60
61 PFNCRYCHLTFTTNGNMHRHMRTHKQFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFR 120
121 CNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSR
Interface Residues: 13, 14, 15, 16, 17, 18, 19, 34, 44, 45, 46, 47, 48, 50, 51, 53, 54, 57, 72, 73, 74, 75, 76, 79, 82, 83, 98, 99, 100, 101, 104, 129, 130, 131, 132, 133, 136, 158, 159, 160, 161, 163, 164
3D-footprint Homologues: 7w1m_H, 1tf3_A, 2lt7_A, 5v3j_F, 2kmk_A, 7y3l_A, 7n5w_A, 8cuc_F, 8gn3_A, 2gli_A, 2drp_D, 8h9h_G, 7y3m_I, 1tf6_A, 7ysf_A, 6e94_A, 2jpa_A, 8ssu_A, 8ssq_A, 1ubd_C, 7txc_E, 6u9q_A
Binding Motifs: peb-F1-3_SANGER_2.5_FBgn0003053 AGCATCm
peb-F1-3_SOLEXA_FBgn0003053 kkdrkGATGCt
peb-F5-7_SOLEXA_FBgn0003053 TTTATCTCaywyyyt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.