Transcription Factor
| Accessions: | peb-F5-7 (FlyZincFinger 1.0 ) |
| Names: | CG12212 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 175 |
| Pfam Domains: | 2-24 C2H2-type zinc finger 34-52 Zinc-finger of C2H2 type 34-56 Zinc finger, C2H2 type 34-56 C2H2-type zinc finger 48-73 Zinc-finger double domain 62-84 Zinc finger, C2H2 type 62-84 C2H2-type zinc finger 87-105 C2H2-type zinc finger 119-142 C2H2-type zinc finger 119-141 Zinc finger, C2H2 type 133-158 Zinc-finger double domain 147-170 Zinc finger, C2H2 type 147-170 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 KYLCPICEVVSATPHEFTNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGER 60 61 PFNCRYCHLTFTTNGNMHRHMRTHKQFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFR 120 121 CNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSR |
| Interface Residues: | 13, 14, 15, 16, 17, 18, 19, 20, 23, 34, 44, 45, 46, 47, 48, 50, 51, 52, 53, 54, 57, 72, 73, 74, 75, 76, 77, 78, 79, 80, 82, 83, 97, 98, 99, 100, 101, 104, 129, 130, 131, 132, 133, 134, 135, 136, 158, 159, 160, 161, 163, 164 |
| 3D-footprint Homologues: | 5k5l_F, 6wmi_A, 7w1m_H, 5und_A, 1tf3_A, 2lt7_A, 5v3j_F, 5kl3_A, 2kmk_A, 7y3l_A, 7n5w_A, 8cuc_F, 4x9j_A, 8gn3_A, 1llm_D, 6blw_A, 5ei9_F, 2drp_D, 1f2i_J, 2gli_A, 1g2f_F, 8h9h_G, 4m9v_C, 7eyi_G, 1tf6_A, 2i13_A, 7y3m_I, 6e94_A, 7ysf_A, 2jpa_A, 8ssu_A, 6ml4_A, 5kkq_D, 5yj3_D, 8ssq_A, 5yel_A, 1ubd_C, 6jnm_A, 6u9q_A, 1mey_C, 7txc_E, 6a57_A, 3uk3_C, 2wbs_A, 5k5i_A |
| Binding Motifs: | peb-F1-3_SANGER_2.5_FBgn0003053 AGCATCm peb-F1-3_SOLEXA_FBgn0003053 kkdrkGATGCt peb-F5-7_SOLEXA_FBgn0003053 TTTATCTCaywyyyt |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.