Transcription Factor

Accessions: 2zhg_A (3D-footprint 20260701)
Names: Redox-sensitive transcriptional activator soxR, SOXR_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0ACS2
Length: 121
Pfam Domains: 4-67 MerR HTH family regulatory protein
4-40 MerR family regulatory protein
46-105 MerR, DNA binding
Sequence:
(in bold interface residues)
1 ALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIP 60
61 LATIGEAFGVTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRN 120
121 P
Interface Residues: 15, 17, 20, 21, 24, 37, 38
3D-footprint Homologues: 6ama_L, 6amk_B, 7ckq_G, 4r4e_B, 6jgx_B, 1r8e_A, 7tec_A, 5d8c_A, 6ldi_G, 2vz4_A, 6xh7_H, 2zhg_A, 1r8d_B
Binding Motifs: 2zhg_A aCtt
Binding Sites: 2zhg_B
Publications: Watanabe S, Kita A, Kobayashi K, Miki K. Crystal structure of the [2Fe-2S] oxidative-stress sensor SoxR bound to DNA. Proceedings of the National Academy of Sciences of the United States of America 105:4121-6 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.