Transcription Factor
| Accessions: | Q8N3J9 (JASPAR 2024) |
| Names: | Zinc finger protein 176, Zinc finger protein 664, Zinc finger protein from organ of Corti, ZN664_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8N3J9 |
| Length: | 261 |
| Pfam Domains: | 3-25 Zinc finger, C2H2 type 3-25 C2H2-type zinc finger 20-40 Zinc-finger double domain 30-40 C2H2-type zinc finger 31-53 C2H2-type zinc finger 49-70 Zinc-finger double domain 58-79 C2H2-type zinc finger 59-81 Zinc finger, C2H2 type 59-81 C2H2-type zinc finger 74-97 Zinc-finger double domain 87-109 C2H2-type zinc finger 87-100 C2H2-type zinc finger 87-109 Zinc finger, C2H2 type 101-126 Zinc-finger double domain 115-137 Zinc finger, C2H2 type 115-137 C2H2-type zinc finger 115-137 C2H2-type zinc finger 133-154 Zinc-finger double domain 143-165 Zinc finger, C2H2 type 143-165 C2H2-type zinc finger 143-165 C2H2-type zinc finger 161-181 Zinc-finger double domain 171-193 Zinc finger, C2H2 type 171-193 C2H2-type zinc finger 189-209 Zinc-finger double domain 199-221 Zinc finger, C2H2 type 199-221 C2H2-type zinc finger 217-237 Zinc-finger double domain 227-247 C2H2-type zinc finger 227-249 Zinc finger, C2H2 type 227-249 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYK 60 61 CDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSEC 120 121 GRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAF 180 181 SQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQST 240 241 SLCIHQRVHTKERNHLKISVI |
| Interface Residues: | 14, 16, 17, 20, 24, 41, 42, 44, 45, 47, 48, 50, 51, 54, 69, 70, 71, 72, 73, 75, 76, 80, 97, 98, 99, 100, 101, 104, 108, 125, 126, 127, 128, 129, 131, 132, 143, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 181, 182, 183, 184, 185, 186, 187, 188, 189, 191, 209, 210, 211, 212, 213, 214, 215, 216, 222, 236, 237, 238, 239, 240, 241, 243, 244, 248 |
| 3D-footprint Homologues: | 5k5l_F, 8ssu_A, 8ssq_A, 7w1m_H, 6blw_A, 2jpa_A, 7n5w_A, 6jnm_A, 5v3j_F, 6wmi_A, 5yj3_D, 8h9h_G, 2lt7_A, 6a57_A, 1tf3_A, 8cuc_F, 1tf6_A, 2i13_A, 8gn3_A, 1llm_D, 5kkq_D, 5ei9_F, 5und_A, 2gli_A, 7eyi_G, 7y3m_I, 6e94_A, 7ysf_A, 5yel_A, 2kmk_A, 6ml4_A, 6u9q_A, 2drp_D, 5k5i_A, 4m9v_C, 1ubd_C, 1g2f_F, 4x9j_A, 1mey_C, 5kl3_A, 7y3l_A, 3uk3_C, 2wbs_A, 7txc_E, 1f2i_J |
| Binding Motifs: | UN0647.1 tAGTAggTGCTCAaTAAAtrt UN0647.2 tAGTAggTGCTCAaTAAAt |
| Binding Sites: | UN0647.1.1 UN0647.1.10 / UN0647.1.9 UN0647.1.10 / UN0647.1.11 UN0647.1.11 / UN0647.1.12 UN0647.1.12 / UN0647.1.13 UN0647.1.14 UN0647.1.15 UN0647.1.16 UN0647.1.17 UN0647.1.18 UN0647.1.19 UN0647.1.2 UN0647.1.20 UN0647.1.3 UN0647.1.4 UN0647.1.5 UN0647.1.6 UN0647.1.6 / UN0647.1.7 UN0647.1.7 / UN0647.1.8 UN0647.1.8 / UN0647.1.9 UN0647.1.13 UN0647.1.16 UN0647.1.17 UN0647.1.18 UN0647.1.19 UN0647.1.20 UN0647.2.1 UN0647.2.10 UN0647.2.11 UN0647.2.12 UN0647.2.13 UN0647.2.14 UN0647.2.15 UN0647.2.16 UN0647.2.17 / UN0647.2.18 UN0647.2.19 UN0647.2.2 UN0647.2.20 UN0647.2.3 UN0647.2.4 UN0647.2.5 UN0647.2.6 UN0647.2.7 UN0647.2.8 UN0647.2.9 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.