Transcription Factor

Accessions: 1c9b_R (3D-footprint 20231221)
Names: TATA BOX BINDING PROTEIN, TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20226
Length: 180
Pfam Domains: 6-88 Transcription factor TFIID (or TATA-binding protein, TBP)
94-178 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSG 60
61 KMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTH 120
121 QQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 180
Interface Residues: 10, 12, 40, 41, 55, 57, 63, 65, 99, 100, 102, 131, 132, 146, 148, 154, 156
3D-footprint Homologues: 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A, 5iy6_P
Binding Motifs: 1c9b_QR tATAAaAg
Binding Sites: 1c9b_S
1c9b_T
Publications: Tsai F.T, Sigler P.B. Structural basis of preinitiation complex assembly on human pol II promoters. The EMBO journal 19:25-36 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.