Transcription Factor

						

			
Accessions: 6byy_D (3D-footprint 20231221), 6wc2_C (3D-footprint 20231221)

			
Names: MEF2 CHIMERA, MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1, MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 89
Pfam Domains:      9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence: 
(in bold interface residues)		   1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD   60
  61 MDKVLLKYTEYSEPHESRTNTDILETLKR
Interface Residues: 2, 3, 14, 17, 18, 22, 56, 67
3D-footprint Homologues: 1n6j_A, 1c7u_A, 7x1n_C, 1hbx_A, 1mnm_A, 7yq3_E
Binding Motifs: 6byy_CD TTnnnnnkAs
6wc2_CDM GCTAnnnnnaGAAAAngC
Binding Sites: 6byy_E
6byy_F
			
Publications: Lei X, Kou Y, Fu Y, Rajashekar N, Shi H, Wu F, Xu J, Luo Y, Chen L. The Cancer Mutation D83V Induces an α-Helix to β-Strand Conformation Switch in MEF2B. J Mol Biol 430:1157-1172 (2018). [Pubmed]


Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.