Transcription Factor

						

			
Accessions: 6ryi_D (3D-footprint 20231221), 6ryi_E (3D-footprint 20231221)

			
Names: AtWUS, Plant growth activator 6, Protein WUSCHEL, WUS_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9SB92
Length: 60
Pfam Domains:      1-60 Homeobox domain
Sequence: 
(in bold interface residues)		   1 TRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARER   60
Interface Residues: 2, 49, 50, 53, 54, 57, 58
3D-footprint Homologues: 6ryd_F, 6wig_A, 5hod_A
Binding Motifs: 6ryi_DE ATCAcgTGA
6ryi_E aTCA
Binding Sites: 6ryi_H
6ryi_I
			
Publications: Sloan J, Hakenjos JP, Gebert M, Ermakova O, Gumiero A, Stier G, Wild K, Sinning I, Lohmann JU. Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL. Nat Commun 11:2223 (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.